PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004512094.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 233aa    MW: 27198.1 Da    PI: 9.3832
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004512094.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.16.5e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k ien +nrqvt+skRrngi+KKA+ELSvLCda+v++i+fs+++k++ey++
  XP_004512094.1  9 KLIENPTNRQVTYSKRRNGIFKKAHELSVLCDAKVSLIMFSKNNKMHEYIT 59
                    569**********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.5E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.469161IPR002100Transcription factor, MADS-box
CDDcd002659.47E-38277No hitNo description
SuperFamilySSF554551.11E-34296IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-27323IPR002100Transcription factor, MADS-box
PfamPF003193.5E-251157IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-273859IPR002100Transcription factor, MADS-box
PfamPF014864.6E-1883169IPR002487Transcription factor, K-box
PROSITE profilePS5129714.09185178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MGRGKIEIKL IENPTNRQVT YSKRRNGIFK KAHELSVLCD AKVSLIMFSK NNKMHEYITP  60
GLSTKKIIDQ YQKTVGDIDL WRSHYEKMLE NLKKLKDINN KLRRQIRHRI GEGGLELDDL  120
SFQQLRSLED DMVSSIAKIR DRKFHVIKTR TDTCRKKVRS LEQMNGNLLL ELCVIHHPSF  180
IFHDEGEEES LANGASTLYA FCHHHSHLNH HHIPHHHHGG EEEAFKTDDL RLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-15162162Myocyte-specific enhancer factor 2B
1tqe_Q7e-15162162Myocyte-specific enhancer factor 2B
1tqe_R7e-15162162Myocyte-specific enhancer factor 2B
1tqe_S7e-15162162Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN4120970.0JN412097.1 Medicago truncatula MADS-box transcription factor TM6 (TM6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004512094.11e-173PREDICTED: floral homeotic protein DEFICIENS-like isoform X2
SwissprotP237064e-71DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLG9HXH21e-152G9HXH2_PEA; MADS-box transcription factor TM6
STRINGGLYMA11G07820.11e-137(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.18e-58MIKC_MADS family protein